SKU LUM-TB500-5 · C₂₁₂H₃₅₀N₅₆O₇₈S · 4963.44 g/mol · CAS 77591-33-4
A synthetic 43-residue fragment of Thymosin Beta-4 supplied as a research reference standard. Studied for cellular migration, actin sequestration, and tissue-repair pathways.
TB-500 is a synthetic acetylated peptide corresponding to a partial sequence of Thymosin Beta-4 (Tβ4). It binds G-actin and modulates actin-cytoskeleton dynamics, and is investigated in cell-migration, angiogenesis, and tissue-repair models. Frequently paired with BPC-157 in comparative healing-axis protocols.
Each vial is lyophilized from acetate buffer, sealed under nitrogen, and held through ship. Insulated tracked shipping is maintained from our lab to your bench.
Research applications
In-vitro cell-migration (scratch/wound) assays, fibroblast proliferation studies, HUVEC tube-formation angiogenesis, and comparative musculoskeletal-repair protocols paired with BPC-157.
Sold for laboratory research only. This material is not a drug, food, or cosmetic and is not intended for diagnostic, therapeutic, or recreational use.
Identity
Parameter
Value
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Molecular formula
C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular weight
4963.44 g/mol
CAS number
77591-33-4
Length
43 residues
Quality
Test
Specification
HPLC purity
99.331%
Mass confirmation
ESI-MS within 0.5 Da
Net peptide content
≥ 80% by AAA
Endotoxin
< 0.5 EU/mg (LAL)
Bioburden
< 10 CFU/g
Residual TFA
< 1.0%
Lot LM-2780
Manufactured 04 Mar 2026 · Released 11 Mar 2026 · Tested by Lumera QC, Canada. Retain samples held under storage spec for five years from release date.
Verification
Method
Result
RP-HPLC at 220 nm
99.08% main peak
ESI-MS (positive)
4963.4 Da (theor. 4963.44)
Amino acid analysis
82.1% net peptide
LAL endotoxin
< 0.05 EU/mg
Karl Fischer (water)
2.8% w/w
Reconstitution
Allow vial to reach room temperature before opening (≥ 20 minutes). Reconstitute with 1.0-2.5 mL of sterile bacteriostatic water (0.9% benzyl alcohol). Inject solvent slowly down the inner wall of the vial; do not direct stream onto the lyophilized cake.
Swirl gently for 30 seconds. Do not vortex. Allow to dissolve for 5 minutes; clarity should be complete with no visible particulates.
Storage after reconstitution
Reconstituted solution is stable for 28 days at 2-8 °C in original vial. For longer storage, aliquot into low-binding tubes and hold at −80 °C; avoid repeated freeze-thaw cycles. Discard if turbidity, color change, or particulate matter is observed.
Selected references
Goldstein AL et al. Thymosin β4: actin-sequestering protein moonlights to repair injured tissues. Trends Mol Med. 2005;11(9):421-429.
Sosne G et al. Thymosin beta 4 promotes corneal wound healing and modulates inflammatory mediators in vivo. Exp Eye Res. 2002;74(2):293-299.
Crockford D et al. Thymosin β4: structure, function, and biological properties supporting current and future clinical applications. Ann N Y Acad Sci. 2010;1194:179-189.
Tb 500 is Thymosin Beta-4 fragment, classified within the actin-sequestration pathway. Structurally it is a synthetic 43-residue Tβ4 fragment. TB-500 is a synthetic acetylated peptide corresponding to a partial sequence of Thymosin Beta-4 (Tβ4), the principal G-actin-sequestering protein in mammalian cells. Goldstein et al. (2005) characterized its role in actin-cytoskeleton dynamics and its emerging significance in tissue-repair models.
In an in-vitro setting, Tb 500 interacts with its target receptor(s) at low-nanomolar affinities under standard binding-assay conditions. Reconstitution should be performed in sterile bacteriostatic water at the working concentration your protocol specifies; the lyophilized vial is sealed under nitrogen and stable until reconstituted.
Common research applications
In-vitro receptor-binding and dose-response screens against the actin-sequestration target panel.
Comparative pharmacology against related class members and previously published reference standards.
Time-course studies leveraging Tb 500's known stability profile.
Cross-batch HPLC fingerprint comparison against the lot-specific COA we publish for every release.
Storage & handling
Tb 500 arrives lyophilized in Canada Post (~4 days). On receipt, transfer immediately to a −20 °C freezer. Once reconstituted, store at 2-8 °C and use within the window noted on the lot's COA. Avoid repeated freeze-thaw cycles.
References
Goldstein AL et al. Trends Mol Med. 2005;11(9):421-9.
Sosne G et al. Exp Eye Res. 2002;74(2):293-9.
Crockford D et al. Ann N Y Acad Sci. 2010;1194:179-89.
For laboratory research only. Tb 500 is sold strictly as an in-vitro reference standard. Sold as an in-vitro reference standard, not as a Health Canada or FDA-approved therapeutic.