Is BPC / TB Blend from Lumera Labs HPLC verified?

Yes. Every BPC / TB Blend lot Lumera Labs ships is HPLC-purity tested at synthesis and retested by Janoshik Analytical before release. The lot-specific Certificate of Analysis is published on the Lab Results page.

Is BPC / TB Blend sold for human use?

No. BPC / TB Blend is sold strictly as a laboratory reference standard for in-vitro research. It is not approved by Health Canada or the FDA for human use. Every order requires a research-use declaration.

How is BPC / TB Blend shipped?

BPC / TB Blend is lyophilized at synthesis, sealed under nitrogen, and shipped from Kelowna, BC at -20 C through cold-chain insulated packaging via Canada Post Xpresspost. Free shipping over $200 CAD. 24-48h transit Canada-wide.

Where can I see the COA for BPC / TB Blend?

Each shipment includes a lot-specific Certificate of Analysis. The current lot's COA is also published at https://lumerapeptide.com/lab-results/ and can be cross-referenced by the batch number printed on each vial.

Home / Catalog / Healing / BPC-157 / TB-500 Blend 10 mg

4.7 · 46 researcher reviews

Healing · Pre-blend

BPC-157 / TB-500 Blend

SKU LUM-BPCTB-10 · Pre-blend · Mixed (1419.55 + 4963.44 g/mol) · CAS Mixed (137525-51-0 / 77591-33-4)

A pre-blended laboratory reference standard pairing BPC-157 with TB-500 in a single vial. Lyophilized for convenience in comparative healing-axis assays.

Purity (HPLC): ≥ 99.12%
Net peptide: 5.00 mg ± 2%
Endotoxin: < 0.5 EU/mg
Format: Lyophilized vial
Storage: −20 °C, desiccated
Shelf life: 24 months from MFG

$120CAD / 10 mg vial

In stock · Lot 26-A031

Qty

Bulk 10+: $24 / vial

Add $200 for free cold-chain shipping

HPLC + MS verified per lot
Cold-chain to your door
COA bundled with shipment
Lot retains kept 5 years

Overview

The BPC / TB Blend pairs the 15-residue Body Protection Compound 157 (BPC-157, GEPPPGKPADDAGLV) with the 43-residue Thymosin Beta-4 fragment (TB-500). The two peptides are co-lyophilized at a fixed mass ratio for convenience in research protocols that screen tissue-repair pathways across multiple mechanisms simultaneously.

Each component meets ≥ 99% HPLC purity independently before blending. Vials are sealed under nitrogen and shipped cold-chain at −20 °C from our Kelowna facility.

Research applications

Combinatorial in-vitro healing-axis assays, tendon-fibroblast outgrowth, angiogenesis (HUVEC tube-formation), and comparative musculoskeletal-repair protocols where both BPC-157 and TB-500 mechanisms are studied in parallel.

Sold for laboratory research only. This material is not a drug, food, or cosmetic and is not intended for diagnostic, therapeutic, or recreational use.

Identity

Parameter	Value
Sequence	GEPPPGKPADDAGLV (BPC-157) + SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (TB-500)
Molecular formula	Pre-blend
Molecular weight	Mixed (1419.55 + 4963.44 g/mol)
CAS number	Mixed (137525-51-0 / 77591-33-4)
Length	Pre-blend (15 + 43 residues)

Quality

Test	Specification
HPLC purity	≥ 99.0% (lot LM-2630: ≥ 99.0% per component)
Mass confirmation	ESI-MS within 0.5 Da
Net peptide content	≥ 80% by AAA
Endotoxin	< 0.5 EU/mg (LAL)
Bioburden	< 10 CFU/g
Residual TFA	< 1.0%

Lot LM-2630

Manufactured 04 Mar 2026 · Released 11 Mar 2026 · Tested by Lumera QC, Kelowna BC. Retain samples held under storage spec for five years from release date.

Verification

Method	Result
RP-HPLC at 220 nm	≥ 99.0% per component main peak
ESI-MS (positive)	Two peaks: 1419.6 + 4963.4 Da
Amino acid analysis	82.1% net peptide
LAL endotoxin	< 0.05 EU/mg
Karl Fischer (water)	2.8% w/w

Reconstitution

Allow vial to reach room temperature before opening (≥ 20 minutes). Reconstitute with 1.0–2.5 mL of sterile bacteriostatic water (0.9% benzyl alcohol). Inject solvent slowly down the inner wall of the vial; do not direct stream onto the lyophilized cake.

Swirl gently for 30 seconds. Do not vortex. Allow to dissolve for 5 minutes; clarity should be complete with no visible particulates.

Storage after reconstitution

Reconstituted solution is stable for 28 days at 2–8 °C in original vial. For longer storage, aliquot into low-binding tubes and hold at −80 °C; avoid repeated freeze-thaw cycles. Discard if turbidity, color change, or particulate matter is observed.