IGF-1 LR3 is a synthetic 83-residue analog of insulin-like growth factor 1, modified with a 13-residue N-terminal extension and an arginine substitution at position 3. The combined modifications dramatically reduce binding to IGF-binding proteins (IGFBPs) and extend the functional half-life relative to native IGF-1.
Each vial is lyophilized from acetate buffer, sealed under nitrogen, and shipped ~4 days from our lab.
Research applications
IGF-1 receptor activation assays, comparative IGFBP-binding studies versus native IGF-1, in-vitro myoblast/fibroblast proliferation models, and PI3K/AKT signaling investigations.
Sold for laboratory research only. This material is not a drug, food, or cosmetic and is not intended for diagnostic, therapeutic, or recreational use.
Identity
Parameter
Value
Sequence
Long Arg³ analog of IGF-1 (extended N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPT + Arg³ substitution)
Molecular formula
C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular weight
9117.55 g/mol
CAS number
946870-92-4
Length
83 residues
Quality
Test
Specification
HPLC purity
99.563%
Certificate of Analysis
The lot-specific COA for this product is available on request. Email support@lumerapeptide.com with your batch number and we will send it.
Allow vial to reach room temperature before opening (≥ 20 minutes). Reconstitute with 1.0-2.5 mL of sterile bacteriostatic water (0.9% benzyl alcohol). Inject solvent slowly down the inner wall of the vial; do not direct stream onto the lyophilized cake.
Swirl gently for 30 seconds. Do not vortex. Allow to dissolve for 5 minutes; clarity should be complete with no visible particulates.
Storage after reconstitution
Reconstituted solution is stable for 28 days at 2-8 °C in original vial. For longer storage, aliquot into low-binding tubes and hold at −80 °C; avoid repeated freeze-thaw cycles. Discard if turbidity, color change, or particulate matter is observed.
