IGF-1 LR3 is a synthetic 83-residue analog of insulin-like growth factor 1, modified with a 13-residue N-terminal extension and an arginine substitution at position 3. The combined modifications dramatically reduce binding to IGF-binding proteins (IGFBPs) and extend the functional half-life relative to native IGF-1.
Each vial is lyophilized from acetate buffer, sealed under nitrogen, and shipped ~4 days from our lab.
Research applications
IGF-1 receptor activation assays, comparative IGFBP-binding studies versus native IGF-1, in-vitro myoblast/fibroblast proliferation models, and PI3K/AKT signaling investigations.
Sold for laboratory research only. This material is not a drug, food, or cosmetic and is not intended for diagnostic, therapeutic, or recreational use.
Identity
Parameter
Value
Sequence
Long Arg³ analog of IGF-1 (extended N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPT + Arg³ substitution)
Molecular formula
C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular weight
9117.55 g/mol
CAS number
946870-92-4
Length
83 residues
Quality
Test
Specification
HPLC purity
99.563%
Mass confirmation
ESI-MS within 0.5 Da
Net peptide content
≥ 80% by AAA
Endotoxin
< 0.5 EU/mg (LAL)
Bioburden
< 10 CFU/g
Residual TFA
< 1.0%
Lot LM-2710
Manufactured 04 Mar 2026 · Released 11 Mar 2026 · Tested by Lumera QC, Canada. Retain samples held under storage spec for five years from release date.
Verification
Method
Result
RP-HPLC at 220 nm
99.05% main peak
ESI-MS (positive)
9117.6 Da (theor. 9117.55)
Amino acid analysis
82.1% net peptide
LAL endotoxin
< 0.05 EU/mg
Karl Fischer (water)
2.8% w/w
Reconstitution
Allow vial to reach room temperature before opening (≥ 20 minutes). Reconstitute with 1.0-2.5 mL of sterile bacteriostatic water (0.9% benzyl alcohol). Inject solvent slowly down the inner wall of the vial; do not direct stream onto the lyophilized cake.
Swirl gently for 30 seconds. Do not vortex. Allow to dissolve for 5 minutes; clarity should be complete with no visible particulates.
Storage after reconstitution
Reconstituted solution is stable for 28 days at 2-8 °C in original vial. For longer storage, aliquot into low-binding tubes and hold at −80 °C; avoid repeated freeze-thaw cycles. Discard if turbidity, color change, or particulate matter is observed.
Selected references
Tomas FM et al. Long-R3-IGF-I biopotency. J Endocrinol. 1993;137(3):413-421.
Francis GL et al. Insulin-like growth factor (IGF)-I and IGF-II analogs binding to type 1 IGF receptor. Biochem J. 1992;284(2):441-447.
Yakar S, Adamo ML. Insulin-like growth factor 1 physiology: lessons from mouse models. Endocrinol Metab Clin North Am. 2012;41(2):231-247.